
Sermorelin, sometimes called GRF 1-29 NH2 with sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2,, is a growth hormone releasing hormone analogue. It is a 29-amino acid polypeptide representing the 1-29 fragment from endogenous human growth hormone releasing hormone, and is thought to be the shortest fully functional fragment of GHRH. It is used as a test for growth hormone secretion. It is also used as doping substance in sports.





CJC 1295 DAC 2mg

HCG 5000iu

TB-500(Thymosin β4)


PT-141 (Bremelanotide)
© 2012 SYNPROTECH.All Rights reserved.
About Us |  News |  Products |  Support |  Contact Us