CJC 1295 no DAC 2mg

CJC-1295 without DAC (CJC-1293), a 29-amino acid peptide with sequence Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2, is a tetrasubstituted peptide analogue of GHRH with D-Ala, Gln, Ala, and Leu substitutions at positions 2, 8, 15, and 27 respectively which can make the peptide more stable. One of its advantages over traditional GHRH is its ability to bioconjugate with serum albumin, thus increasing its half-life and therapeutic window. It accomplishes this by using protecting groups around the amino acids of GHRH typically susceptible to enzymatic degradation. In clinical research, the objective of the peptide was to treat visceral fat deposits in obese AIDS patients, as increased levels of exogenous HGH are presumed to increase lipolysis (fat loss).

 

BPC-157

follistatin-344

CJC 1295 DAC 2mg

HCG 5000iu

TB-500(Thymosin β4)

Sermorelin

PT-141 (Bremelanotide)
© 2012 SYNPROTECH.All Rights reserved.
SYNPROTECH PHARMA Co.,Ltd
About Us |  News |  Products |  Support |  Contact Us